SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005129 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005129
Domain Number 1 Region: 395-462
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000995
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005129   Gene: ENSOGAG00000005735   Transcript: ENSOGAT00000005739
Sequence length 506
Comment pep:known_by_projection scaffold:OtoGar3:GL873546.1:19124239:19471727:1 gene:ENSOGAG00000005735 transcript:ENSOGAT00000005739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYPSSKPATSTFPSSFFMQDGHHSSD
PWSSSSGMNQPGYGGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHR
SGTNHYSTSSCTPPANGTDSIMANRGSGAAGGSQTGDALGKALASIYSPDHTNNSFSSNP
STPVGSPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAV
GPSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGAHREDGVALRGSH
SLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQD
TKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPEQKAEREKERRMANNARERLRVRDIN
EAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKV
SSEPPPLSLAGPHPGMGDASNHMGQM
Download sequence
Identical sequences H0WSQ8
ENSOGAP00000005129 ENSOGAP00000005129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]