SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005300 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005300
Domain Number 1 Region: 81-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.36e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005300   Gene: ENSOGAG00000005928   Transcript: ENSOGAT00000005930
Sequence length 215
Comment pep:known_by_projection scaffold:OtoGar3:GL873527.1:15836583:15837230:1 gene:ENSOGAG00000005928 transcript:ENSOGAT00000005930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPHPLGSPTVQVTREMKQPFPRASDHQVTCAVSAPPSPALTPRDCAEAEAGGCRGPPRK
LRARRGGRSRPKNELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLT
KIETLRFAHNYIWALTQTLRIADHSFYGLEPPALSYGELGSPDGGSAGDWGSLYSPASQA
GSLSPAASLEERPGLRVAASPACQCPGAQAFADFL
Download sequence
Identical sequences H0WT49
ENSOGAP00000005300 ENSOGAP00000005300 XP_003783652.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]