SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005416 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005416
Domain Number 1 Region: 55-838
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-292
Family Motor proteins 1.95e-16
Further Details:      
 
Domain Number 2 Region: 839-964
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.88e-22
Family Myosin rod fragments 0.00031
Further Details:      
 
Domain Number 3 Region: 959-1075
Classification Level Classification E-value
Superfamily Myosin rod fragments 2.35e-20
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 4 Region: 1245-1352
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.97e-18
Family Myosin rod fragments 0.0024
Further Details:      
 
Domain Number 5 Region: 1064-1153
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000235
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 6 Region: 1351-1453
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000136
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 7 Region: 1517-1630
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000532
Family Myosin rod fragments 0.0012
Further Details:      
 
Domain Number 8 Region: 1762-1863
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000053
Family Regulator of G-protein signaling, RGS 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000005416
Domain Number - Region: 27-60
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.011
Family Myosin S1 fragment, N-terminal domain 0.0015
Further Details:      
 
Domain Number - Region: 1629-1746
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0811
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 1853-1924
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0902
Family Myosin rod fragments 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005416   Gene: ENSOGAG00000006049   Transcript: ENSOGAT00000006060
Sequence length 1963
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:11314173:11407305:1 gene:ENSOGAG00000006049 transcript:ENSOGAT00000006060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASVKEELGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVDMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAHVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDASTVDRIIGLDQVAGMTETALPGAFKTRKGMFRTVGQLYKEQLAKL
MATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEF
RQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDL
KITDVIIGFQACCRGYLARKAFAKRQQQLTAMRVLQRNCAAYLKLRNWQWWRLFTKVKPL
LQVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCA
EAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEES
ARQKLQLEKVTTEAKLKKLEEDQIIIEDQNCKLAKEKKLLEDRIAEFTTNLMEEEEKSKS
LAKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQ
LAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERAARNKAEKQKRDL
GEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHDAQIQEMRQKHSQA
VEELAEQLEQAKRVKGNLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQEL
QVKFNEGERVRTELADKVTKLQVELDSVTGLLSQSDSKSSKLSKDFSTLESQLQDTQELL
QEETRQKLSLSTKLKQMEDEKNSFKEQLEEEEEAKHNLEKQISTLHAQVADMKKKMEDGV
GCLETAEEAKRKLQKDLEGLSQRHEEKVAAFDKLEKTKTRLQQELDDLLVDLDHQRQSVS
NLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELER
LNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLR
LEVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSIAVAARKKMEM
DLKDLEAHIDTANKNREEAIKQLRKLQAQMKDCMRELDETRTSREEILAQAKENEKKLKS
MEAEMMQLQEDLAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEE
LEEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEM
EGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRAEKKLKDVLLQVEDERRN
AEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSL
KNKLRRGDLPFVVPRRMARKGTGDCSDEEVDGKADGAEAKPAE
Download sequence
Identical sequences H0WTE2
ENSOGAP00000005416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]