SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005461 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005461
Domain Number 1 Region: 110-341
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-21
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005461   Gene: ENSOGAG00000006112   Transcript: ENSOGAT00000006113
Sequence length 538
Comment pep:known_by_projection scaffold:OtoGar3:GL873569.1:10388105:10410937:-1 gene:ENSOGAG00000006112 transcript:ENSOGAT00000006113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSCPEPEQVQLPRADAIRSRLIDTFSLIEHLQGLSQAVPRHTLRELLDPARQKKLMLGD
QHQLVRFSIKPQHAGRISHAQRKMSRLRVRCSRRPPLSLWAGWVLECILSWHNFIIFLIF
LNTIVLMVEIELMESTNAKLWTLKLTLEVAAWFILLIFILEILLMWLSSFLLFWKSAWNV
FDFIVTMLSLLPEIVVLGGVTSQSVWLQFLRICRVLRSLKLFARFRQIRVIILALVRALK
SMTFLLMLLLIFFYIFAVTGVHFFAEYTRSTRQDLEYHLFFSDLMNSLVTVFILFTLDHW
YALLQDIWKVPEVGRLFSSLYVILWLLLGSIIFRNIIVAMMVTNFQNIRKELSEEMTHLE
VQHKADIFKRRIIQRRQNLSPEAIRSSHSKMDTSRPSRQMVSSEAYEDEFKTNEAEEGVD
DFKSIDTKEETIGVSKTEEISSKEKQYPLSSSSSSISSSSSSSSESRYTELIEKLDWETL
VHQNLPGLMEMDQDDRVVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNFEDK
Download sequence
Identical sequences H0WTH7
ENSOGAP00000005461 ENSOGAP00000005461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]