SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005558 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005558
Domain Number 1 Region: 535-891
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.27e-111
Family PDEase 0.00000229
Further Details:      
 
Domain Number 2 Region: 362-530
Classification Level Classification E-value
Superfamily GAF domain-like 2.03e-47
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 178-361
Classification Level Classification E-value
Superfamily GAF domain-like 6.11e-33
Family GAF domain 0.000000023
Further Details:      
 
Domain Number 4 Region: 2-155
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000169
Family GAF domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005558   Gene: ENSOGAG00000006218   Transcript: ENSOGAT00000006227
Sequence length 895
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:29698824:29729933:1 gene:ENSOGAG00000006218 transcript:ENSOGAT00000006227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDALLSLGSVIDIAGLRRAVKEALSAVLPRVETVYTYLLDGESRLVCEDPHHELPQEGKV
REAVISRKRLGCNGLGPSDLPGKALARLAAPLAPDTQVLVIPLVDKEAGAVAAVILVHCA
QLSDSEEWSLQAVEKHTLVALRRVQAVQQRRPGEAPREVQNPPEATADDQKGRVAYSDQD
RKILQLCGELYDLDASSLQLKVLQYLQQETRASCCCLLLVSEDNLQLSCKVIGDKVLGEE
ISFPLTGRLGQVVEDKKSIQLKDLTSQEDVQQLQSMLGCELQAMLCVPVISRATDQVVAL
ACAFNKLGGELFTEQDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTH
LDDVSVLLQEIITEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIA
GHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKING
PWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLL
HDGIQPVAAIDSNFANFTYTPRSLPEDDTSFAILSMLQDMNFINNYKIDCPTLARFCLMV
KKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNS
FQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIIL
ATDLAHHLRIFKDLQKMAEVGYDRTNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELI
YKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYE
RVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE
Download sequence
Identical sequences H0WTQ9
ENSOGAP00000005558 ENSOGAP00000005558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]