SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005575 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005575
Domain Number 1 Region: 155-250
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.12e-33
Family ets domain 0.0000048
Further Details:      
 
Domain Number 2 Region: 24-118
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.03e-26
Family Pointed domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005575   Gene: ENSOGAG00000006242   Transcript: ENSOGAT00000006245
Sequence length 255
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:61308919:61340187:-1 gene:ENSOGAG00000006242 transcript:ENSOGAT00000006245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDSVTHSTFLPNTSFCDPLMSWTDLFGNEEYYPAFEHQTACDSYWTSVPPEYWTKRHVW
EWLQFCCDQYKLDTSCISFCHFNISGLQLCSMTQEEFVEAAGVCGEYLYFILQNVRAQGY
SFFNDAEETKATIKDYADSNCLKTSGIKSQECHSHSRTSLQSSHLWEFVRDLLLSPEENC
GILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLV
YKFGKNAHGWQEDKL
Download sequence
Identical sequences H0WTS4
ENSOGAP00000005575 XP_003781274.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]