SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005719 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005719
Domain Number 1 Region: 181-342
Classification Level Classification E-value
Superfamily RNI-like 4.97e-46
Family 28-residue LRR 0.0000044
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000005719
Domain Number - Region: 115-188
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.068
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005719   Gene: ENSOGAG00000006400   Transcript: ENSOGAT00000006403
Sequence length 345
Comment pep:novel scaffold:OtoGar3:GL873693.1:1838166:1843631:1 gene:ENSOGAG00000006400 transcript:ENSOGAT00000006403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSYQKELEKYRDIDEDEILRTLSPEELEQLDCELQEMDPENMLLPAGLRQRDQTKKSPT
GPLDREALLQYLEQQALEVKERDDLVPFTGEKKGKPYIQPKREIPAQEQITLEPELEEAL
AHATDAEMCDIAAILGMYTLMSNKQYYDAICSGEICNTEGISSVVQPDKYKPVPDEPPNP
TNIEEILKRVRSNDKELEEVNLNNIQDIPIPMLSELCEAMKTNTYVRNLSLVATRSGDPI
ANAVADMLRENRSLQSLNIESNFISSTGLMAVLKAVRENATLTELRVDNQRQWPGDAVEM
EMATVLEQCPSIVRFGYHFTQQGPRARAAQAMTRNNELRRQQKKR
Download sequence
Identical sequences B4UT04
XP_012667231.1.62490 ENSOGAP00000005719 ENSOGAP00000005719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]