SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005726 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005726
Domain Number 1 Region: 44-229,353-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.87e-50
Family FAD-linked reductases, N-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005726   Gene: ENSOGAG00000006406   Transcript: ENSOGAT00000006410
Sequence length 476
Comment pep:known_by_projection scaffold:OtoGar3:GL873539.1:565620:583343:1 gene:ENSOGAG00000006406 transcript:ENSOGAT00000006410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAQGSTMAARLSVCRWGAAPAAVHRGPLVSWWRCSSTLADTVYDVVVSGGGLVGAAMAC
ALGHDIHFRDKKILLLEAGPKKVMERLPETYSNRVSSISPGSATLLSSFGAWDHICKMRY
RAFRRMQVWDACSEALIMFDKDNFDDMGYIVENDVIMHALTKQLEAVSDRVTVRYRSKAV
GYTWPCPFPMTDSSPWVHITLGDGSTLQTKLLIGADGHNSGVRQAAGIQNVSWNYDQSAV
VATLYLSEATENNVAWQRFLPSGPIALLPLSDTLSSLVWSTSHEHAAELVSMDEEKFVDA
INSAFWSDANHTDFINSTGTALQYAIALLKPTKVSARQLPPSVARVDAKSRVLFPLGLGH
AAEYVRPRVALIGDAAHRVHPLAGQGVNMGFGDISSLVHHLSTAAFNGRDLGSMSHLTGY
ETDRQRHNTALLAATDLLKRLYSTSATPLVLLRTWGLQATNALSPLKEQIMAFASK
Download sequence
Identical sequences H0WU49
ENSOGAP00000005726 ENSOGAP00000005726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]