SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005800 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005800
Domain Number 1 Region: 439-506
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005800   Gene: ENSOGAG00000006485   Transcript: ENSOGAT00000006490
Sequence length 506
Comment pep:known_by_projection scaffold:OtoGar3:GL873530.1:9653822:9743765:1 gene:ENSOGAG00000006485 transcript:ENSOGAT00000006490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLLRQDIGLGSPAQLSSSGKPGTPYYSFSTTSSRRRPLHDSAALDPLQAKKVRKVPPGL
PSSVYAPSPNSDDFNRESPSYPSPKPPTSMFASTFFMQDGTHNSSDLWSSSNGMSQPGFG
GILGTSTSHMSQSSSYGSLHSHDRLSYPPHSVSPTDISTSLPPMSSFHRGSTSSSPYVAA
SHTPPINGSDSILVCRKSSAPVTVSYSALAGAARSSIYSPDHTSSSFPSNPSTPVGSPSP
LTGTSQWPRPGGQAPSSPSYENSLHSLQSRMEDRLDRLDDAIHVLRNHAVGPSTSLPAGH
GDIHSLLGPSHNTPIGSLNSNYGGSSLVTSSRSASMIGTHREDSVSLNGNHSVLSSTVTA
SSTDLNHKTQENYRGGLQSQSGTVVATEIKTENKEKDENLHEPPSSDDMKSDDESSQKDI
KVSSRGRTSSTNEDEDLNPEQKIEREKERRMANNARERLRVRDINEAFKELGRMCQLHLK
SEKPQTKLLILHQAVAVILSLEQQVR
Download sequence
Identical sequences H0WUB0
ENSOGAP00000005800 ENSOGAP00000005800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]