SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005834 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005834
Domain Number 1 Region: 71-202
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.59e-46
Family Regulator of G-protein signaling, RGS 0.00000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005834   Gene: ENSOGAG00000006526   Transcript: ENSOGAT00000006526
Sequence length 210
Comment pep:known_by_projection scaffold:OtoGar3:GL873645.1:3378554:3471135:1 gene:ENSOGAG00000006526 transcript:ENSOGAT00000006526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKRQQSQNEGTPAVSQTPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTQTTK
MESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDL
KKEQNKKVIEEKARTIYEDYISILSPKEVSLDSRVREVINRNLLDPSPHMYEDAQLQIYT
LMHRDSFPRFLNSQIYKSFVESTAGSSSES
Download sequence
Identical sequences H0WUD7
ENSOGAP00000005834 XP_003797913.1.62490 ENSOGAP00000005834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]