SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005837 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005837
Domain Number 1 Region: 82-133
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000785
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005837   Gene: ENSOGAG00000006528   Transcript: ENSOGAT00000006529
Sequence length 214
Comment pep:known_by_projection scaffold:OtoGar3:GL873541.1:18082209:18085323:1 gene:ENSOGAG00000006528 transcript:ENSOGAT00000006529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQREVRRTSAMAAVGHIQSKAKARLLPDPDRKRSRLSRTRRDLWGEASWSNHRWSGAAP
GPLRARERGLTLGRSESSPENAARERSRVRTLRQAFLALQATLPAVPPDTKLSKLDVLVL
AASYIAHLTRTLGHELPSPAWPPILRGLRYLHPLKKWPMRSRLYAGGLGGSGLDSTTATA
SGQRTRNAEVAPQVSGKADAFLPTKPLSPALGAK
Download sequence
Identical sequences H0WUD9
ENSOGAP00000005837 ENSOGAP00000005837 XP_003787516.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]