SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005865 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005865
Domain Number 1 Region: 217-378,417-479
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.41e-43
Family Voltage-gated potassium channels 0.0023
Further Details:      
 
Domain Number 2 Region: 482-668
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-42
Family cAMP-binding domain 0.002
Further Details:      
 
Domain Number 3 Region: 40-136
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-19
Family Flavin-binding PAS domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005865   Gene: ENSOGAG00000006555   Transcript: ENSOGAT00000006562
Sequence length 962
Comment pep:known_by_projection scaffold:OtoGar3:GL873697.1:1229845:1650910:-1 gene:ENSOGAG00000006555 transcript:ENSOGAT00000006562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMAGGRRGLVAPQNTFLENIVRRSNADTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAE
VMQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNE
QDKVVLFLCTFSDITAFKQPIEDDSCKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVH
KHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNV
SFKTRQNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVID
LLSCLPYDVINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVF
GLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLAMDIGTPYQFNGSGSGKWEGGPSK
NSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIGSLLYATIFGNVTTIFQQMY
ANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTEKVLQICPKDMRAD
ICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSL
EVIQDDEVVAILGKGDVFGDVFWKEATLAQSCANVRALTYCDLHVIKRDALQKVLEFYTA
FSHSFSRNLILTYNLRKRIVFRKISDVKREEEERMKRKNEAPLILPPDHPVRRLFQRFRQ
QKEARLAAERGGRDLDDLDVEKGNVLTEHASANHNLVKASVVTVRESPATPVAFQAASTS
GVPDHAKLHAPGSECLGPKAGGGDCAKRKGWARFKDACGKGEDWNKVSKAESMETLPERT
KASGEATLKKTDSCDSGITKSDLRLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATV
LEVRHELKEDIKALNAKMTSIEKQLSEILRILTSRRSSQSQELFEISRPQSPESERDIFG
AS
Download sequence
Identical sequences H0WUG4
ENSOGAP00000005865 ENSOGAP00000005865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]