SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005882 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005882
Domain Number 1 Region: 274-519
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.45e-82
Family Eukaryotic proteases 0.0000458
Further Details:      
 
Domain Number 2 Region: 184-280
Classification Level Classification E-value
Superfamily SRCR-like 7.06e-20
Family Hepsin, N-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000005882
Domain Number - Region: 163-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000157
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005882   Gene: ENSOGAG00000006577   Transcript: ENSOGAT00000006581
Sequence length 527
Comment pep:known_by_projection scaffold:OtoGar3:GL873627.1:6601537:6618282:1 gene:ENSOGAG00000006577 transcript:ENSOGAT00000006581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPARTSARTSPTETSPAGTSPARASPTGTSSARTSSARSSSARASPARASPARASPSRSS
SSRSSSARSASVASSPTRVYLVRATPVGAVPVRASAARSAPATRATRESPGISLPKFSCR
EGLKRLPLIGCVLLLIALVASLIILFYFWRGHTGIKYKEQVESCPKHAVRCDGVVDCKLK
SDELGCVRFDWDKSLLKVYSGSSHQWLPICSDSWNESYSEKTCQQLGFESAYRTTKVAHK
DFASSFSVSEYNSTIQESLQRSECPSQNYVSLQCSHCGLRAITGRIVGGALASESKWPWQ
VSLHYGTTHICGGTLIDAQWVLTAAHCFFVTREKMLDGWKVYAGTNNLQQLPEAASISQI
IINSNYTDEEDDYDIALMRLSKPLTLSAHIHPACLPMYGQTFSLNETCWITGFGKTKETD
GRSSYRTERVCVCVCLCFMCSELCLDDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCEQN
SRWYLTGVTSWGTGCGQKNKPGVYTKVTEVLPWIYSKMESEVRFRKS
Download sequence
Identical sequences H0WUH4
ENSOGAP00000005882 ENSOGAP00000005882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]