SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005915 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005915
Domain Number 1 Region: 356-613
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.18e-91
Family Tyrosyl-DNA phosphodiesterase TDP1 0.000000000219
Further Details:      
 
Domain Number 2 Region: 151-354
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.28e-71
Family Tyrosyl-DNA phosphodiesterase TDP1 0.00000000515
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005915   Gene: ENSOGAG00000006613   Transcript: ENSOGAT00000006617
Sequence length 614
Comment pep:known_by_projection scaffold:OtoGar3:GL873539.1:16020346:16100644:1 gene:ENSOGAG00000006613 transcript:ENSOGAT00000006617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFRSIMSQEGDYGKWTISSSDESEDEKPKLDKPSTSFLSHAGQEATNEPRYTCSEARKAA
QRRKISPVKFNNTDSGSPPKRQRSDSQEYLGWCLSSSDDELQPETPEKQAKKVIVKEEED
ISVPQDGTAQRTGNHSTPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGIK
PKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDWLIKQYPPEFRKKPILLVHGDKREAK
ADLHAQAKPYGNISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHEDWHQKTQG
IWLSPLYPRIVHGTHKSGESVTHFKADLISYLMAYNASPLKEWIDLIHEHDLSETNVYLI
SSTPGRFQGSQKDNWGHFRLRKLLKEHASSIPAAESWPIVGQFSSIGSLGADESKWLSSE
FKESLLTLGKESKAPGKSTVPLHLIYPSVENVRTSLEGYPEAGGSLPYGIQTAEKQNWLH
SYFHKWSAETSGRSHAMPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGAQLMI
RSYELGVLFLPSAFGLDSFKVKQKFFSANKEPMATFPVPYDLPPELYGNKDRPWIWNIPY
VKAPDTHGNMWVPS
Download sequence
Identical sequences H0WUJ9
ENSOGAP00000005915 ENSOGAP00000005915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]