SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005954 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005954
Domain Number 1 Region: 932-1042
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-36
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 2691-2802
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-35
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 3 Region: 3156-3282
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-35
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 4 Region: 1053-1159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-35
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 5 Region: 589-701
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-35
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 6 Region: 2230-2337
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-33
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 7 Region: 1396-1508
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-33
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 8 Region: 1170-1278
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-33
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 9 Region: 2454-2567
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-33
Family Spermadhesin, CUB domain 0.00066
Further Details:      
 
Domain Number 10 Region: 3039-3151
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-32
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 11 Region: 3404-3509
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-32
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 12 Region: 1741-1851
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-32
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 13 Region: 2338-2449
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.26e-31
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 14 Region: 1626-1736
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.3e-30
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 15 Region: 1279-1389
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-30
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 16 Region: 1510-1618
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-30
Family Spermadhesin, CUB domain 0.00088
Further Details:      
 
Domain Number 17 Region: 1860-1967
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-29
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 18 Region: 3513-3624
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-28
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 19 Region: 1992-2092
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-28
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 20 Region: 2094-2215
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.28e-26
Family Spermadhesin, CUB domain 0.00095
Further Details:      
 
Domain Number 21 Region: 824-925
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-26
Family Spermadhesin, CUB domain 0.00099
Further Details:      
 
Domain Number 22 Region: 2573-2689
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-25
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 23 Region: 707-815
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-25
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 24 Region: 469-585
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-25
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 25 Region: 2918-3037
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-23
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 26 Region: 2807-2920
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-21
Family Spermadhesin, CUB domain 0.00089
Further Details:      
 
Domain Number 27 Region: 3291-3398
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-17
Family Spermadhesin, CUB domain 0.0054
Further Details:      
 
Domain Number 28 Region: 133-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000952
Family EGF-type module 0.011
Further Details:      
 
Domain Number 29 Region: 432-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000104
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 30 Region: 260-400
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000235
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 31 Region: 392-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family EGF-type module 0.017
Further Details:      
 
Domain Number 32 Region: 170-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000073
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000005954
Domain Number - Region: 213-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0477
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005954   Gene: ENSOGAG00000006645   Transcript: ENSOGAT00000006658
Sequence length 3626
Comment pep:known_by_projection scaffold:OtoGar3:GL873538.1:15989672:16234966:1 gene:ENSOGAG00000006645 transcript:ENSOGAT00000006658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGDMASPIVFTLVTLLTLAELDGEAVELELQQRNRNIDLQQPRMATERGNLVFLTGSSQN
IEFRTGSLGKIKLNDEDLSECLHQIQKNKDDITNLKESATGLPQNISSQIHQLNSKLMDL
ERKFQGLQQTLDKTACGSNPCQHGGTCLNLHDSFFCICPSQWKGPLCSDDVNECEIYSGT
PMSCQNGATCMNTVGSYSCHCSPDTYGPQCASKYDDCEGGSKALCIHGICEDLVREQVGK
PKYSCICDAGWTSPPNSSACTVDRDECSLQPEPCSTHVQCFNTQGSFYCGACPTGWRGNG
YFCEDVDECEMNNGGCSVSPPVECVNTPGSYHCRACPPGYQGDGRVCTIIDICSANNGGC
HPNAACSSALGSLPLCTCPPGYTGNGYGPNGCVQLSNMCLSHPCLNGECTETVSGYFCKC
ESGWAGVNCTENINECLSNPCLNGGACVDGVNSFHCECTRFWTGPLCQNPQQVCGESLTG
INGSFSYQSPDVGFLHDVNCFWVIRTEAGKVLRISFTFFQLDWANNCPHEFLQIYDGDSS
AALQLGRFCGFSPPGELFSSDNALYFHFYSEHLRSQRGFTVRWETQQPECGGTLTGTYGS
IKSPGYPGNYPPGRDCVWLVITSPDLLITFTFGTLSLEHHDDCSKDYLEIRDGPLHQDPI
LGKFCTTLSAPPLQTTGPFARIHFHSDAQISDQGFHITYLTSPLDLPCGGNYTDPEGELL
LSEMSGPFTQNRQCVYIITQPPGEQIQVNFTHVQLESQGGCAQSYIEVRDYETLLGKVCD
NGTISHFKSITNNVWIRFKIDASIEKASFRAVYQVACGGEVTGEGVIHSPYYPNVYPGER
TCQWTIHQPQSQIVLLNFTAFEIGSSAHCDTDYIEIGSSSVLGSLENKKYCGPDTPPPIT
TMHNVLYVTFVKSSSPENHGFVAKFGTELLACGATLREPEGVIQSPGHPNTYPQGINCTW
HITVQPTHLIRLIFERFYLEFHYNCANDYLEVYDTDSETPLGRYCGKSIPPSLTSRGNSL
TLVFVADSDLAYEGFLINYEAIDASTACLEDHTSESGTLTSPNYPNDYPNNWECIYRITV
ESSQQIALHFTNFSLEEAFGGNCHSDFLEIRDGGYETSPLLGIYCGSNLPPTIISHSNKL
WLKFQSDMVISMSGFSAYWDGSSTGCGGNLTTSRGTFTSPNYPMPYYHSSECYWWLKSSR
GSPFELQFTDFHLEHHPNCTLDYLAVYDGPSTSSHLLAQLCGDKKPPLIRSSGDSMFLKL
RTDEGQQGRGFEVEYWQTCENVVIVNQTYGILESINYPNPYSRNLRCNWTIQATTGNTVN
YTFLAFDMEDHTSCSADYLELYDGPQQMGRYCGENMPPPGSTAGSRLHVLFHTDGVGHQE
KGFQMQWSIHGCGAELSGATGSFSSPGYPGRYPANKECIWYIKTAPGSSIQLTIHDFDVE
YHARCNFDVLEIYGGPDFHAPRIAQLCFQLSSENPMQVSSTGNELAVRFKTDSSINGRGF
NASWQAIPGGCGGIFQAPHGEIHSPNYPSPYRSNTDCSWVIKVERNHRVLLNFTDFDLEP
QDSCIMAYDGVSSITTRLARTCGRQQLANPITSSGDSLFVRFLSGPSRQSRGFRAQFKQV
CGGHILMDSSGTISSPLFPAKYPNNQNCSWILEAQPPFNHITLSFTHFEVEGGTTCTRDF
VEILDGNQDDAPLRGRYCGGSISMPHPVTSFGSALTLRFVSDSTIRDGGFHAVITASSSA
CGGTFHMAEGIFDSPGYPEVYPPNTECVWNIVSSPGSQLQLSFISFQLEDSQDCSRDFVE
IREENATGHLVGRYCGHSLPDNFSSTIEHSLWVKFVSDGSGSGIGFQAMFTKIFGNDNIV
GTHGKIASPFWPGNYPHNSNYQWIVNVNVSQVVYGRILEMDIEETNNCYYDKLRVYDGIG
IHSRLIGTYCGTHTESFSSTGNSLTIQFSSDFSVSGKGFLLEWFAVDAPVGPLPTIAPGA
CGGFLRTGDEPVFLFSPGWPDRYGNNVECTWLIQAPDSTVELDILSLDIEADSACNYDKL
VIRDGDNNMAPELAILCGREIPRPIWSTGEHMFIRFTSDMSVTGKGFNASFHKSCGGYRH
ADRGIITSPNYPESYKPNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSFCNQGDYLVLKN
GPDIHSPPLGPPGGNGHFCGSRPSSTLFTSDNEMFVRFISDSSNEGQGFKIKYEAKSLAC
GGNIYIHDADSAGYVTSPNHPDNYPQHTDCIWIIAAPQGKSIRLQFEDQFSIEASPDCTS
SYLELRDGADSNAPVLSKFCGMSLPGSQLSSGEVMYLRFRTDNSPTHVGFKAKYSIAQCG
GTVTGQAGVIESIGYPALPYTDNLFCEWHLQGLPGHYLTISFEDFHLQNSSGCEKDFLEI
WDNRTSGSILGKYCGNNIPDSVDTSSNVALVRFVTDDSLTASGFKLRFASSLQGCGGDLQ
GPTGTFTSPNYPNPNPHGRVCEWRITVPEGRRVTLTFTDLRLEALPSCDSEQVQVFNGIR
RNSPQLEKLCSSVNVSSELESSGNTMKVVFVTDGSRPYGGFAASYTSSEDAVCGGPLTSA
PEGNVTSPGYDGVHNYSRNLNCEWTLSNPNEGNSSIYIQFQNFSLESHQNCDHDLLEFRV
GHANGPMIRKFCGPSIPTVPLVIPYRQVWIHFVTNDHVERIGFHAEYSFTDCGGIQMGES
GVISSPNYPNRYESLTHCAWLLKAPQGHTITLTFTDFDIEAHSVCSWDSVTVRNGGTPGS
PIIGQYCGNSNPRAIQSGSNQLVVIFNSDHSIEGGGFYATWNTQTLGCGGTLHLSNGVIK
SPHWPENFPENIRCSWTVITHLSKHLEISFDDNFLIPSSDGRCQNSFVKVWTGTQEVENA
LLATGCGNVAPATIITPENKFTAVFQSQERPAQGFSASFVSRCGRNFTRSTGYMYSPNYP
KHYENNLNCTYVIKANPQSVVMLTFVSFHLEARSAVTGSCDNDGVHIIRGLSLASTPFVT
VCGAERLAPVTVVGPMLLNFYSNAQITDYGFKFSYRITPCGGVFNFSSGIIKSPAYSYSN
YPNDMYCLYTILASDDKVMQLKFNDFDVVPSISCSHDYLEIYDGSNTSDPLLGKFCGSKK
PPNVKSSGNTVLLVFKTDSFQTARGWKISFRQTLGPQHGCGGYLTAPNTTFVSPDSDLDG
RYDNSLNCIWFITAPVNKVIKLTFSTFALEAASSMKLCRFDYIKVYDGDSENANVAGTFC
GSTVPAPFVSSGNFLMVQFVTDLSVEREGFNATYTIVDMPCGGTYNASWTPQNASSPNSS
DPEFPFTTCTWVIEAPVHQQVKITVWSLELHSQNCAQSYLEFQDSPQRNRHPGIQFCGRN
ASAVPVFYSSMSTAIVIFKSAVFATNSRVSFTYQIADCNREYNKEFGNLRSPGWPEDYNS
NLDCIVVLRAPQNHIISLFFHSFGIEDSSECRRDFLEIRNGNDSSSPLLGKYCGTLLPNP
VFSQSNELYLRFKSDGIISSHGYEIIWTSSPSGCGGTLYGDRGSFTSPGYPGTYPNNTHC
EWTLIAPSGRLLTISFYFVSIDDPGDCVQNYLILYDGPSADSPFSGPYCGADTSIAPFMA
SSNRVFIKFHAASAAHPSAFQLTWDS
Download sequence
Identical sequences H0WUM7
ENSOGAP00000005954 ENSOGAP00000005954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]