SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005979 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005979
Domain Number 1 Region: 1779-2024
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.84e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 798-928
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000014
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 3 Region: 469-511
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000393
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 4 Region: 1109-1250
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000518
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 5 Region: 510-624
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000107
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 390-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000554
Family EGF-type module 0.00072
Further Details:      
 
Domain Number 7 Region: 430-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000636
Family EGF-type module 0.002
Further Details:      
 
Domain Number 8 Region: 607-731
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000408
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 9 Region: 184-318
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000102
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 10 Region: 924-967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000138
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 11 Region: 67-201
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000785
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 12 Region: 1337-1376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000084
Family EGF-type module 0.017
Further Details:      
 
Domain Number 13 Region: 1081-1123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000102
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 1248-1298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000384
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 963-1007
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 16 Region: 1467-1500
Classification Level Classification E-value
Superfamily Notch domain 0.0000000798
Family Notch domain 0.0035
Further Details:      
 
Domain Number 17 Region: 735-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000017
Family EGF-type module 0.013
Further Details:      
 
Domain Number 18 Region: 311-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000196
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 19 Region: 1001-1041
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000248
Family EGF-type module 0.013
Further Details:      
 
Domain Number 20 Region: 353-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000472
Family EGF-type module 0.017
Further Details:      
 
Domain Number 21 Region: 42-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000714
Family EGF-type module 0.027
Further Details:      
 
Domain Number 22 Region: 1386-1418
Classification Level Classification E-value
Superfamily Notch domain 0.000000981
Family Notch domain 0.0012
Further Details:      
 
Domain Number 23 Region: 1426-1458
Classification Level Classification E-value
Superfamily Notch domain 0.00000209
Family Notch domain 0.0049
Further Details:      
 
Domain Number 24 Region: 1048-1088
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000005
Family EGF-type module 0.04
Further Details:      
 
Domain Number 25 Region: 773-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000716
Family EGF-type module 0.031
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000005979
Domain Number - Region: 1291-1325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.025
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005979   Gene: ENSOGAG00000006680   Transcript: ENSOGAT00000006686
Sequence length 2316
Comment pep:known_by_projection scaffold:OtoGar3:GL873624.1:479905:515900:-1 gene:ENSOGAG00000006680 transcript:ENSOGAT00000006686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGARGHRRRRRPMWLPLPPPPMRALPLLLLLAGSGAAAPPCLDGSPCANGGRCTQLPS
REAACLCPPGWVGEWCQLEDPCHSGPCAGRGVCQSSVVAGSARFSCRCPRGFRGPDCSLP
DPCLSSPCAHGARCSVGADGRFTCSCPPGYQGRSCRSDVDECRVVGPCRHGGTCLNTPGS
FHCQCPVGYTGPLCESPTVPCAPSPCRNGGTCRQSGDITYDCACLPGFEGQNCEVNVDDC
PGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSC
VCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPC
HEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCG
RGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVN
GGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCKNGAKCVDQPDGYECRCAEGFEGT
LCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDL
VDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINE
CASSPCGDGGSCVDGENGFRCLCPLGSLPPLCLPPSHPCAYEPCSHGVCHDAPGGFRCVC
EPGWSGPRCSQSLARDTCESQPCQAGGTCTSDGMGFHCTCPPGVQGRQCELLSPCTPNPC
EHGGQCESAPGQLTVCSCPPGWQGLRCQQDVDECAGSSPCGSHGTCTNLAGSFSCTCHSG
YTGPSCNQDINDCDPNPCLNGGSCQDGVGSFLCSCLPGFAGLRCAHDVDECLSNPCGPGT
CTDHVASFTCSCPPGYGGLHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCH
HEADLCLSRPCLHGGVCSTAYPGFRCACPEGFTGPQCQTLVDWCSSMPCQNGGRCVQTGA
YCLCPPGWNGRLCDTRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCPEGRTGSH
CEQELDPCLAQPCQHGGTCRGYMGGYVCECLAGYAGDDCEDDVDECASQPCQHGGSCIDL
VARYLCSCPPGTLGVLCEINEDDCGPGLLLHSGPQCLHNGTCVDLVGGFRCTCPPGYTGL
RCEADINECRSGGCHAAHTRDCLQDPGGSFHCLCHSGFTGPRCQTVLSPCESQPCQHGGQ
CRPSPGAGGGLTFACHCVPPFWGPRCERVARSCRELQCPVGVPCQQTARGPRCACPPGLS
GPSCRGSRGSPPGASNASCAAAPCLHGGSCHPTPHVPFFRCTCAPGWTGPRCEAPAAEPE
VSEEPRCPRSTCQAKRGDKRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNS
RCDPACSSPACLYDNFDCHAGGRERACNPVYEKYCADHFADGRCDQGCNTEECGWDGLDC
ASEVPALLARGVLVLTVLLPPEQLLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHR
PSPDSEPRSRRELAPEVIGSVVMLEIDNRLCLQSSENDHCFPDAQSAADYLGALSAVERL
DFPYPLRDVRGEPLEPPEPSVPFLPLLVAGAVFLLVILVLGVMVARRKREHSTLWFPEGF
ALHKDLASGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPSMG
AEEAVDCRQWTQHHLVAADIRVAPAMALTPPQGEADTDGMDVNVRGPDGFTPLMLASFCG
GSLEPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLD
AGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEG
MVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAA
REGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLG
PLLCPPGAFLPGLKVTQSGAKKSRRPPGKAGLGPQGARGRGKKLTLACPGPLAESSVTLS
PVDSLDSPRPFGGPPASPSGFPMEGPYAAATATAVSLAQLGGAGRAGLGRQPPGGCVLSL
GLLNPVAVPLDWARLPPPAPPGPSFLLPLAPAPQLLNPGTPISPQERPPPYLAAPGHAEE
YPTAGAHGSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPATATATG
ALPAQPLPLSVPGSLAQAQTQLGPQPEVTPKRQVLA
Download sequence
Identical sequences H0WUP6
XP_003796553.1.62490 ENSOGAP00000005979 ENSOGAP00000005979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]