SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000005988 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000005988
Domain Number 1 Region: 2-26,57-230
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.41e-26
Family GidA-like 0.018
Further Details:      
 
Domain Number 2 Region: 90-127,299-362
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000565
Family FAD/NAD-linked reductases, N-terminal and central domains 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000005988   Gene: ENSOGAG00000006692   Transcript: ENSOGAT00000006696
Sequence length 622
Comment pep:known_by_projection scaffold:OtoGar3:GL873554.1:16519954:16539185:1 gene:ENSOGAG00000006692 transcript:ENSOGAT00000006696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLGQMSCNPSFGGIGKGHLMREVDALDGLCSRICDQSGIHYKVLNRRKGPAVWGLRAQID
RKLYKQNMQKEILNTPLLTVQEGAVEDLILTEPEPAHPGKCRARGVVLADGSAIYAESVI
LTTGTFLRGMVVIGLEMHPAGRLGDQPSIGLAQTLEKLGFAVGRLKTGTPPRIAKDSINF
SILNKQTPDNPSLPFSFLNETVWIKPEDQLPCYLTHTNPRVDEIVLENLHLNSHVKETTR
GPRYCPSIESKVLRFPNRIHQVWLEPEGMDSDLIYPQGLSVTLPAELQEKMITCIRGLEK
AKMIQPGYGVQYDYLDPRHISPSLETHLVQRLFLAGQINGTTGYEEAAAQGVIAGINASL
RVSRKPPFVLSRTEGYIGVLIDDLTTLGTSEPYRMFTSRVEFRLSLRPDNADSRLTFRGY
KEAGCVSQQRYERASWMKSSLEEGISVLKSIEFSSSKWKKLIPQAPISTSRSLPVSALDV
LKYEEVDMELLAQAVPDPLRKYTQCRELADRLKIEATYESVLVFQLQQIEEVQRDEALQL
PHDLDYLSVKDVSLSHEVREKLHLIRPRTIGAASRIPGVTPAAIVNLLRFVKTTQQSRAA
VDELPKTDQYLRDTDRLQEREL
Download sequence
Identical sequences H0WUQ3
ENSOGAP00000005988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]