SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006124 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006124
Domain Number 1 Region: 484-823
Classification Level Classification E-value
Superfamily Folate-binding domain 1.43e-87
Family Aminomethyltransferase folate-binding domain 0.0000175
Further Details:      
 
Domain Number 2 Region: 67-288,391-476
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.74e-57
Family FAD-linked reductases, N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 288-382
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.49e-26
Family L-aminoacid/polyamine oxidase 0.01
Further Details:      
 
Domain Number 4 Region: 825-919
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.0000000000000196
Family Aminomethyltransferase beta-barrel domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006124   Gene: ENSOGAG00000006836   Transcript: ENSOGAT00000006844
Sequence length 921
Comment pep:known_by_projection scaffold:OtoGar3:GL873606.1:2855327:2915693:-1 gene:ENSOGAG00000006836 transcript:ENSOGAT00000006844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSRALRAATACPRWSPVQGLGLRSLTSVDGPTAEKSVPYQRTLKEAQDPLAVTQGPS
QPLPSTANVVVIGGGSLGCQTLYHLAKLGVSGAVLLERERLTSGTTWHTAGLLWQLRPSD
VEVELLAHTRRLVSRELEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKVYGVESH
VLSPAETKALYPLMNVDDLYGTLYVPHDGTMDPAGTCTTLTRAATARGAQVIEHCPVTGI
RVRTDDFGVRRVMAVETEHGSIQTPCVVNCAGVWAGAVGQMAGVKVPLVAMHHAYVVTER
IQGIQNMPNVRDHDASVYLRLQGDALSVGGYETNPIFWEEVSDKFAFGLFDLDWDVFTQH
IEGAVNRVPVLEKTGIKSTVCGRKPQESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLG
GGCGQELAHWIIHGRPEKDMYSYDIRRFHQSLTDHRRWVRERSHESYAKNYSVVFPHDEP
LAGRNMRTDPLHEELLGRGCVFQERQGWERPGWFYPRGTVPVLEYDYYGAYGNQAHEDHA
YGRLLADEYTFDFPPHHDTIRAECLACREAAAVFDMSYFGKFYLVGPDARAAADWLFSAD
VSRPPGSTVYTCMLNHRGGTESDLTVSSLAPGPQASPLAPAFEGDGYYLAVGGAAAQHNW
SHITTVLQDQRFQCQLIDSSEDLGMISIQGPASRAILQEVLDADLSDEAFPFSTHKLVTA
AGHLVRAMRLSFVGELGWELHIPRVSCVPVYQAVMAAGARHGLVNAGYRAIDSLSIEKGY
RHWHADLRPDDSPLEAGLAFTCKLKSPVPFLGREALEKQRASGLRRRLVCFTVEEKVPML
GLEAIWRDGHMVGHIRRADFGFTIHKTIAYGYVRDPCGGPVSLDFVKSGNYALERMGVTY
TAQARLKSPFDPDNKRVKGIY
Download sequence
Identical sequences H0WV12
ENSOGAP00000006124 ENSOGAP00000006124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]