SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006237 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006237
Domain Number 1 Region: 140-296
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.7e-17
Family Nuclease 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006237   Gene: ENSOGAG00000006971   Transcript: ENSOGAT00000006972
Sequence length 433
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:7120332:7134958:-1 gene:ENSOGAG00000006971 transcript:ENSOGAT00000006972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPRHVGKIRKRLEDVKSQWVRPARADFSDNESARLATDALLDGGPEAYWRALSKEGEV
DFLSSVEAQYIQAQAKEPPCAADPPGGAEAGTKGLDSSSLQSGTYFPVASEGSEPALLHT
WTSAEKPYLREKSSATVYFQMDKHNNIRDLVRRCIARASQVLVVLMDLFTDVEIFCDILE
AANKRGVFVCVLLDQGGVKLFQEMCDKVQISDSHLKNISIRSVEGEVYCAKSGRKFAGQI
QEKFIISDWRFVLSGSYSFTWLCGHVHRNILSKFTGQAVEPFDEEFRHLYASSKPVMGLK
SPRLAAPLLPGASHSLPSGLSSSHSASDRTSSDPFSSPSTDSHPHNQSLSTSSGPGSPGT
PNPPPPPRIQPYHSPWGALSPQAHFCPRPHNGPPALYSNLNAYRPTRLQLEQLGLVPRLA
HTWRPFLQASPHF
Download sequence
Identical sequences H0WVA8
ENSOGAP00000006237 ENSOGAP00000006237 XP_003782417.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]