SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006243 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000006243
Domain Number - Region: 100-195
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0201
Family DBL homology domain (DH-domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006243   Gene: ENSOGAG00000006972   Transcript: ENSOGAT00000006978
Sequence length 339
Comment pep:known_by_projection scaffold:OtoGar3:GL873566.1:3690869:3706417:-1 gene:ENSOGAG00000006972 transcript:ENSOGAT00000006978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEALAEFIKRTLLKIPLTEMTTILKAWDFLSENQLQTVNFRERKESIVQHLALLCEEKH
ASLNDAAILDIIYTQVHRHQKMWDVFQMSKGPDEDVDLFDMKQFKSTFKKILQRALKNVT
VSFRDTEDNAVWIRIAWGTQYTKPNQYRPTYVVYHSQTPYAFASISTLKRNVPLLGQALM
IASKHHQITKMDLRSRYLDSLKAIVFKQYNQNFETHYSATPLQERSLGLDINMDSRIIHE
NITEKEKVQRITLETFGDCPQPQLEFAQYKLETKFKSDLNASILAERKEPLRCLIKFSSP
HLLEALKSLAPAGIADAPLSPLLTCIPNKRMNYFKIRDK
Download sequence
Identical sequences H0WVB4
ENSOGAP00000006243 ENSOGAP00000006243 XP_003791355.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]