SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006252 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006252
Domain Number 1 Region: 424-682
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.24e-72
Family Eukaryotic proteases 0.0000000347
Further Details:      
 
Domain Number 2 Region: 19-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-31
Family Spermadhesin, CUB domain 0.000000791
Further Details:      
 
Domain Number 3 Region: 174-286
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-24
Family Spermadhesin, CUB domain 0.0001
Further Details:      
 
Domain Number 4 Region: 358-428
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000431
Family Complement control module/SCR domain 0.0000244
Further Details:      
 
Domain Number 5 Region: 299-361
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000445
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 127-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000265
Family EGF-type module 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006252   Gene: ENSOGAG00000006982   Transcript: ENSOGAT00000006987
Sequence length 687
Comment pep:known_by_projection scaffold:OtoGar3:GL873623.1:1683259:1691584:-1 gene:ENSOGAG00000006982 transcript:ENSOGAT00000006987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRCIVLFSLLAWVCAEPTMYGEILSPNYPQAYPNEIEKSWDIEVPEGYGIHLYFTHVDIE
LSENCAYDSVQIMSGDNEEGRLCGQRTRKNPNSPIVEEFQVPSNKLQVTFKSDFSNEERF
TGFAAYYVAVDINECTDFADVPCSHFCNNFIGGYFCSCPPEYFLHDDMRNCGVNCSGDVF
TTPIGEIASPNYPNLYPENSRCEYQILLEKGFQIVVTMHKDFDVEPADSEGNCPDSLVFS
AQGQQFGPYCGNGFPGPLNIETKSNVLDIIFQTDLTEQKKGWKLRYHGEPIPCPKEDTAN
SVWEPEKAKYVFKDVVKINCLEGFEVVAGSVGSASFYATCQSNGKWSNSKVKCQPVDCGI
PDPIPNGKVEDPESTLFGSVTRYTCEEPYYYMEHEGSGEYRCAGNGSWVNEVLGTELPKC
VPVCGVPREPFIEKQRIFGGSNAKIESFPWQVFFKSPWAGGALIGEHWVLTAAHVVEGNQ
HPIMYVGSTLVKSSLLENAQMLTAERVFIHPGWEALDDSDSRKNFDNDIALVQLKDPVKM
GPTVSPICLPGTSADYNPSVDLLGMISGWGRIEKREYALHLKGAKLPIVPLEKCKNVKKK
NSNINVASYVFTNNMFCAGGEKGVDSCKGDSGGAFAIQDPNESTPKFYVAGLVSWGPECG
TYGLYTQVKNYVDWIMKTMQENSPSEK
Download sequence
Identical sequences H0WVC2
ENSOGAP00000006252 ENSOGAP00000006252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]