SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006272 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000006272
Domain Number - Region: 143-381
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.00193
Family Penicillin V acylase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006272   Gene: ENSOGAG00000007005   Transcript: ENSOGAT00000007008
Sequence length 395
Comment pep:known_by_projection scaffold:OtoGar3:GL873640.1:77370:108347:1 gene:ENSOGAG00000007005 transcript:ENSOGAT00000007008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGQTHLRLVLLTAAVTYTVAQHAPPWTEDCRKSTYPPSGPTYRGPVPWYTINLDLPPYK
RWHELMADKAPQLKVIVNSLKNIVNAFVPSGKVMQMVDQKLPGLLGNFPGPFEEEMKGIA
AVTDIPLGEIISFNIFYEFFTMCTSIITEDKVGHLLHGRNMDFGVFLGWNINNNTWVVTE
ELKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFNMDGGYLGILEWI
LGKKDAMWIGFITRSVLENSTSYEEAKNILTKTKILAPAYFILGGNQSGEGCVITRGRKE
SLDIYDLDPKYGRWYVVQTNYDRWKSPFFLDDRRTPAKMCLNRITQENISFATLYDVLST
KPVLNKLTAFTTLIDVTRGQYETYLRDCPDPCIGW
Download sequence
Identical sequences H0WVD9
ENSOGAP00000006272 ENSOGAP00000006272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]