SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006290 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006290
Domain Number 1 Region: 303-387,478-512,561-657
Classification Level Classification E-value
Superfamily RNI-like 1.15e-25
Family Cyclin A/CDK2-associated p19, Skp2 0.04
Further Details:      
 
Domain Number 2 Region: 181-266
Classification Level Classification E-value
Superfamily F-box domain 3.92e-19
Family F-box domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000006290
Domain Number - Region: 507-551
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0765
Family Blood coagulation inhibitor (disintegrin) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006290   Gene: ENSOGAG00000007026   Transcript: ENSOGAT00000007030
Sequence length 668
Comment pep:known_by_projection scaffold:OtoGar3:GL873747.1:1878997:1912264:-1 gene:ENSOGAG00000007026 transcript:ENSOGAT00000007030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLCVKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDN
KLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFT
YEELKDIKKKVIAQHCSQKDTAELLRGLSLWNQAEERQKFFKYSVDEKSDKEAEVSEHST
GITHLPPEVMLSIFSYLNPQELCRCSQVSTKWSQLAKTGSLWKHLYPVHWARGDWYSGPA
TELDTEPDEEWVKNRKDESRAFHEWDEDADIDESEESAEESVAISIAQMEKRLLHGLIHN
VLPYVGPSVKTLVLAYSSAVSSKMVRQILELCPNLEHLDLTQTDISDSAFDSWSWLGCCQ
SLRHLDLSGCEKITDVALEKISRALGILTSHQSGSLKASASKITSTMWKNKDITTHSTKQ
YACLHDLTNKGVGEEIDNEHPWTKPVPAENFTSPYVWMLDAEDLADIEDAVEWRHRNVES
LCVMDTASSFSCPTSACYSKDIVGLRTSVCWQQHCASPAFAYCGHSFCCTGTTLRTMSAL
PESSAICRKASRTRLTEGKDLIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLRVLTLGG
GLPFLEHLNLSGCLTVTGAGLQDLVSACPSLNDEYFYYCDNINGPHADTASGCQNLQCGF
RACCRSGE
Download sequence
Identical sequences H0WVF6
ENSOGAP00000006290 ENSOGAP00000006290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]