SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006341 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006341
Domain Number 1 Region: 538-570,651-725
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.51e-16
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006341   Gene: ENSOGAG00000007081   Transcript: ENSOGAT00000007084
Sequence length 780
Comment pep:known_by_projection scaffold:OtoGar3:GL873524.1:1221535:1271830:-1 gene:ENSOGAG00000007081 transcript:ENSOGAT00000007084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGGGSEPPQLPEYSYSYVVSRPVYSELAFQQKHERRLQERKTLRESLTKSCSCSRKR
AFGVLKSLMPILEWLPKYRIKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPIGYGLYSA
FFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSMAPDENFLVSSVNGTAANTTLIDSAA
RDAARVLIASTLTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVL
NVSTKNYNGVLSIIYTLVEIFQNIGHTNLADFIAGLLTIVICMAVKELNDRFKHKIPIPI
PIEVIVTIIATAISYGADLENNYNAGIVKSIPRGFLPPVLPSVSLFSEMLAASFSIAVVA
YAIAVSVGKVYATKYDYTIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKT
QIAGIISAVIVMIAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVCDVPRLWRQNKIDAV
IWVFTCVVSIILGLDLGLLAGLIFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIE
EPEGVKILRFSSPIFYGNVDGFKKSIKSTVGFDAIRVYNKRLKALRKIQKLIKNGQLRAT
KNGIISDAGTPNNAFEPDEDIEDPEELDIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVL
DCGAISFLDVVGVRSLRVIVKEFQRIDVNVYFASLQDHVIEKLERCGFFDDNIRKDTFFL
TVHDAILYLQNQVKSQEGQDSILETITLIQDCKDPLELMGAELMEEELDVQDEAMRRLAS
Download sequence
Identical sequences H0WVJ7
XP_003782839.2.62490 ENSOGAP00000006341 ENSOGAP00000006341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]