SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006348 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006348
Domain Number 1 Region: 523-555,637-711
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000961
Family Anti-sigma factor antagonist SpoIIaa 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006348   Gene: ENSOGAG00000007084   Transcript: ENSOGAT00000007091
Sequence length 759
Comment pep:known_by_projection scaffold:OtoGar3:GL873524.1:1138579:1167917:1 gene:ENSOGAG00000007084 transcript:ENSOGAT00000007091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPFGNQYIVARPVYSANDFGEEHKKIERYHKTFLDHLKLCCSCSAQKAKGIALSLFPI
ASWLPAYRPKEWILSDIVSGVSTGLVSVLQGLAFALLVNISPVYGLYAAFFPCIVYFFLG
TSRHISVGKSVVELMTTHIAFSLSIYCINSKXELTNSSASNVSLSLEERKVLVAATVSML
AGIIQLIMGVLRIGFVVVYLSESLISGFTTAAAIHVLVSQLKFILQLQVPPHTDPFSIFK
VLESIFTQIEKTNIADLVSSLIILVIVTVFKEINQRFKSKLPVPIPIEFIMTVIATGVSY
GFDFQNRFNVSVVGKMQSGFQPPITPNAATFQETIGDSFGIAIVAFAVAFSVASVYSLKH
DYQLDGSQELIALGLGNIVGGAFRGFAGSTALSRSAIQESTGGKTQIAGIISAIIVLIVI
VGIGFLLEPLQKSVLAALALGNLKGMLMQFSEIGRLWKKDKYDCLIWIVTFILTIVLGLG
IGLGASVAFQLLTIVFRTQFPKCSTLANVGRSNIYKNKKDYLDMYEPEGVKIFRCPSPIY
FANIGFFRQKLIDAVGFSPLRILRKRNKALKKIRKLQKQGQLQVTPKGVICTAYSVKDSD
EELDNNQVEELDQPINTADLPFEIDWNADLPFNIAVPRISIHSLILDFSAVSFLDTSSMR
GLKKILQEFLRVKVDVYIVGSDDDFIEKLTRCEFFDEEVKSSVFFLTIHDAILHILMKKD
YSTSKFNSYQEKDTKVDFTINTNGGLRKREYQVPSETRF
Download sequence
Identical sequences H0WVK3
ENSOGAP00000006348 ENSOGAP00000006348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]