SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006390 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006390
Domain Number 1 Region: 22-101
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000000998
Family Snake venom toxins 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006390   Gene: ENSOGAG00000007132   Transcript: ENSOGAT00000007136
Sequence length 127
Comment pep:known_by_projection scaffold:OtoGar3:GL873810.1:120023:121700:1 gene:ENSOGAG00000007132 transcript:ENSOGAT00000007136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGMQLALLVLVLAACGELVAALQCYTCQEPMSVASCITITTCHANETMCKTTLYSLEIV
YPFLGDSTVTKSCASKCEPSDVDGIGQTRPVSCCNTELCNVDGAPALDSPCGLALVITLI
PILSLQF
Download sequence
Identical sequences H0WVP2
XP_003803325.1.62490 ENSOGAP00000006390 ENSOGAP00000006390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]