SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006455 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006455
Domain Number 1 Region: 112-164
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000955
Family Hairy Orange domain 0.0000529
Further Details:      
 
Domain Number 2 Region: 50-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006455   Gene: ENSOGAG00000007210   Transcript: ENSOGAT00000007214
Sequence length 304
Comment pep:known_by_projection scaffold:OtoGar3:GL873523.1:44719349:44722002:1 gene:ENSOGAG00000007210 transcript:ENSOGAT00000007214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRTHADYSSSDSELDETIEVEKESADESGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAM
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHTGLGHIPW
GSAFGHHPHIAHPLLLPQNGHGNTGTTASPTEPHHQGRLASAHPEAPALRAPPSGGLGPV
LPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPWGTE
IGAF
Download sequence
Identical sequences H0WVV1
XP_003782583.1.62490 ENSOGAP00000006455 ENSOGAP00000006455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]