SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006476 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006476
Domain Number 1 Region: 152-393
Classification Level Classification E-value
Superfamily RNI-like 1.18e-40
Family Cyclin A/CDK2-associated p19, Skp2 0.00000000133
Further Details:      
 
Domain Number 2 Region: 89-144
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000131
Family F-box domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006476   Gene: ENSOGAG00000007236   Transcript: ENSOGAT00000007242
Sequence length 424
Comment pep:novel scaffold:OtoGar3:GL873582.1:4308170:4336675:1 gene:ENSOGAG00000007236 transcript:ENSOGAT00000007242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRKHLQEIPDQSSNVSTSFTWGWDSSKTSELLSGMGVSALEKEEVDSENIPQELLSNLS
HPQSPPRKRLKSKGNDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYRLAFDESLWQTLDLTGKNLSPDVIGRLLSRGVIAFRCPRSFVDQPLVEHFSP
FRVQHMDLSNSVMDVSILHGILSQCSKLQNLSLEGLRLSDPIVNNLAQNSNLIRLNLSGC
SGFSEMALKTLLSSCSRLEELNLSWCYDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DVSTLVRRCPNLVHLDLSDSVMLKNDCFQEFYQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTTGNKKNQEIWGIRCRLTLQK
PSCL
Download sequence
Identical sequences H0WVW3
ENSOGAP00000006476 ENSOGAP00000006476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]