SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006496 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006496
Domain Number 1 Region: 19-47,94-178
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-25
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Domain Number 2 Region: 278-358
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-21
Family Voltage-gated potassium channels 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006496   Gene: ENSOGAG00000007264   Transcript: ENSOGAT00000007264
Sequence length 380
Comment pep:known_by_projection scaffold:OtoGar3:GL873540.1:4953769:4965768:-1 gene:ENSOGAG00000007264 transcript:ENSOGAT00000007264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASGQARRCCPEATGKLFPGLCFLCSLVTYALVGAALFSAIEGGQVLGAENQEFEEFLE
GLCSILECNGTAMRGRKEKVQEHLRKVNPQWLSRSADWSFLSSLFFCCTVFSTVGYGHIY
PVTRLGKYVCMLYALFGIPLMFLVLTDTGDILATILSTSYNRFRKLSFFTHHLSKWCSQL
FCRRKPATRPADEAIPQITVTAEELPGPAPSKCPSAPSHNLELFERFLAQEKHNKLQLPT
QAMERSTSCPELVSGKLSYSIISNLDEVGQQVEKLDVPLPIIVLVVFAYISCAAAVLPFW
EKHLDFESAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIVGMEIVFIAFKLVQNRLIH
IYKNLLLFFAKGKFYHLIKK
Download sequence
Identical sequences H0WVX9
XP_003787178.1.62490 ENSOGAP00000006496 ENSOGAP00000006496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]