SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006545 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006545
Domain Number 1 Region: 693-885
Classification Level Classification E-value
Superfamily RNI-like 8.9e-36
Family 28-residue LRR 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000006545
Domain Number - Region: 157-308
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000243
Family Nucleotide and nucleoside kinases 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006545   Gene: ENSOGAG00000007309   Transcript: ENSOGAT00000007313
Sequence length 975
Comment pep:known_by_projection scaffold:OtoGar3:GL873627.1:5482199:5492083:-1 gene:ENSOGAG00000007309 transcript:ENSOGAT00000007313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWGCHLPRASWGSGLGRAPQPQDERIPFLTHWSWPFKGEHHLGPPRAFVRHNGSSAGSA
PPSARQRQLFGSISAVEAIQRHRRNLAEWFSRLPREERQFGPTFALDTVHVDPVIRESNP
DELLRPSAELALDHQPPLAGLPPLALSQLFDPDACGRRVQTVVLYGKVGTGKSTLVRKMV
LDWCYGRLPAFELLIPFSCEDLSSLGPAPASLCQLVAQRYLPLKEVLPLMAAAGSRMLFV
IHGLERLNLDFRLAGTGLCSDPEKPEAPAAIVVNLLRKYMLPEASILVTTRPSAIGRIPS
KYVGRYGEICGFSDTNLQKLYFQLRLNQPDCGHAAWGAGVSATPAQRDNLVQMLSRNLEG
HHQISAACFLPSYCWLVCATLYFLHAPTPAGQTLTSIYTSFLRLNFSGETLDSTDPSNLS
LMAYAARTMGKLAYEGVSSRKTYFSEEDVRGCLEAGIKTEEEFQLLHVFRRDALRFFLAP
CVEPGHLGTFVFTVPAMQEYLAALYIVLGLRKTTLQQVGKEVAELVGRVGEDVSLVLSIV
AKLLPLRALPLLFNLLKVVPRVFGRVMGKSRDAVAQAMVLEMFREEDYYNDDVLDQMGAS
ILGVEGPRRHPDEPPEDEVFELFPIFMGGLLSAHNRAVLAQLGCPIKNMDALENAQAIKK
KLGKLGRQVLPPSELLDYLFFHYEFQNQRFSAEVLRSLHRLNLAGVRMTPLKCTVVAAVL
GSGRHTLEEVNLASCQLDPAGLRTLMPVFLRARKLGLQLNSLGPDACKDLRDLLLHKQCQ
ITTLRLSNNPLTAEGVALLVEGLAGNTSLTHLSLLHTGLGDKGLELLATQLDRNQQLQEL
NVAYNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGSTTEGGARVVASL
TEGAAVSEYWSVILSEVQRNLNSWDRARVRRHLELLLRDLEDSRGATLNPWRKAQLLRVE
SEVRALLEQLGGPGS
Download sequence
Identical sequences H0WW22
ENSOGAP00000006545 ENSOGAP00000006545 XP_003796867.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]