SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006597 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006597
Domain Number 1 Region: 2-173
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-32
Family Voltage-gated potassium channels 0.0024
Further Details:      
 
Domain Number 2 Region: 189-354
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000065
Family Potassium channel NAD-binding domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006597   Gene: ENSOGAG00000007370   Transcript: ENSOGAT00000007376
Sequence length 1076
Comment pep:known_by_projection scaffold:OtoGar3:GL873527.1:8351716:8889634:1 gene:ENSOGAG00000007370 transcript:ENSOGAT00000007376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALR
LIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALT
YWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYG
GSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKR
HFTQVEFYQGSVLNHMTQVMANVKSIESADACLILANKYCADPDAEDASNIMRVISIKNY
HPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANL
FSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEY
KSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGC
KRPKMSIYKRMRRACCFDCGRSERDCSCMSGRVRGNVDPLERAFPLSSVSVNDCSTSFHA
FEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMF
HWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELK
HIVFVGSIEYLKREWETLHNFPKVSILPPKGTPLSRADLRAVNINLCDMCVILSANQNNI
DDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSI
TTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFN
DNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL
GDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF
CLMQFDHNAGQSRASLSHSSHSSQSSSKKSASVHSIPSTANRQNRPKSRESRDKQNATRM
NRMGQAEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIPPIREVEDEC
Download sequence
Identical sequences H0WW58
ENSOGAP00000006597 ENSOGAP00000006597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]