SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006627 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006627
Domain Number 1 Region: 276-431
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.91e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000757
Further Details:      
 
Domain Number 2 Region: 149-267
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-34
Family Spermadhesin, CUB domain 0.0000203
Further Details:      
 
Domain Number 3 Region: 37-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-33
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 4 Region: 642-798
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.2e-26
Family MAM domain 0.0016
Further Details:      
 
Domain Number 5 Region: 546-596
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000281
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006627   Gene: ENSOGAG00000007405   Transcript: ENSOGAT00000007412
Sequence length 914
Comment pep:known_by_projection scaffold:OtoGar3:GL873532.1:25271816:25352305:-1 gene:ENSOGAG00000007405 transcript:ENSOGAT00000007412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGIFTTMFWNIFICVSVYSRVGSGRDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIV
YAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSM
LYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTI
LAKPKMDIVLQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELR
SSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLDNFQCNVPLGMESGRIANEQISASSTY
SDGRWTPQQSRLHGDDNAWTPNLDSSKEYLQVDLRFLTMLTAIATQGAISRETQNDYYVK
SYKLEVSTNGEDWMVYRHGKNHKVFQANSDATEVVLNKLHSPLLTRFVRIRPQTWHLGIA
LRLELFGCRVTEGPAEKLKSSPHLPFMHSECICQVSIRKPLKFPGIPKIFSQHTNVPQHI
SSNESGSFQMNKNLGLKMRLPSIIVSDVRDREEKGEGRTRGVGRGGEDKGGGEGCPGGRA
EPSASLQLFEGSMHYDTPDIRRFEPVPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTVKSEETTTPYPIDEETTECGENCSFEDDKDLQLPSGFNCNFDFPEESCGWMYG
RNSKQKWLRKELSPWSASGVGIEGRMERNFLRLQSDSRREGQHARLISPPVHLPRSPVCM
EFQYQATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDLEYQIVFEGMI
GKGRTGEIAIDDIRISTDVPLENCMEPISAFTATLFCVSPPGGTLPPGTEPTVDTVPVQP
IPAYWYYVMAAGGAVLVLVSVALALVLHHHRFRYAAKKTDHSITYKTSHYTNGAPLAVEP
TLTIKLEQDRGSRC
Download sequence
Identical sequences H0WW83
ENSOGAP00000006627 ENSOGAP00000006627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]