SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006641 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006641
Domain Number 1 Region: 7-141
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.31e-36
Family Cap-Gly domain 0.00075
Further Details:      
 
Domain Number 2 Region: 110-349
Classification Level Classification E-value
Superfamily RNI-like 4.79e-27
Family Cyclin A/CDK2-associated p19, Skp2 0.024
Further Details:      
 
Domain Number 3 Region: 440-528
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.57e-23
Family Ubiquitin-related 0.0000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006641   Gene: ENSOGAG00000007422   Transcript: ENSOGAT00000007427
Sequence length 528
Comment pep:known_by_projection scaffold:OtoGar3:GL873635.1:4326173:4384658:1 gene:ENSOGAG00000007422 transcript:ENSOGAT00000007427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANDTLTSDVIGQRVEVNGEYATVRFLGLVPPVAGCWLGVEWDNPERGKHDGSHKGTAYFK
CSHPTGGSFIRPNKVNFGIDFLTAVKNRYALEDGPEENRKEEVVLIGSKPVETVGFDSVI
KLQSQLSKLQDISLRNCAVSRAGEKGGTARACPNIRKVDLSKNLLSSWDEVVNITDELRC
LEVLNLSENKLKYPSGSASVTGTFSALKILVLNRAGITWAEVLRCVSGCPVLEELHLESN
NIIISERPTDVLQTVKLLDLSSNKSIDENQLFLIAYLPRLEQLILSDIGISSIHFPDAGI
GCKTSMFPALQYLIVNDNQISQWSFINELDKLPHLHALSCIRNPLMEGERTAQTTRQLII
AKIGQLKTLNKCEILPEERHGAELDYRKTFGNEWRKAGGHQDPDKNRPNEEFLAAHPRYQ
LLCLKYGAPEDEELKVQQPFMLKNHLLTLKIKCPNQLEQKVLEKQLPDSMTIQKVKGMLS
RVLKVPVSDLLLSYESPKMPDREIDLENDLQSLQFYSVENGDCLLVRW
Download sequence
Identical sequences H0WW96
ENSOGAP00000006641 ENSOGAP00000006641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]