SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006720 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006720
Domain Number 1 Region: 478-582
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000114
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006720   Gene: ENSOGAG00000007512   Transcript: ENSOGAT00000007516
Sequence length 607
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:2503963:2522584:-1 gene:ENSOGAG00000007512 transcript:ENSOGAT00000007516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSVKALGQPRSSSPGMVPNTCCCTSAAVRRRLPVLAWLPNYSLQWLKMDFIAGLSVGL
TVIPQALAYAEVAGLPPQYGLYSAFMGCFVYLFLGTSRDVTLGPTAIMSLLVSFYTFHEP
AYAVLLAFLSGCIQLAMGFLHLGWPGFLLDFISCPVIKGFTSAAAVTIGFGQIKNLLGLQ
NIPRQFFLQVYHTFRSIGETRVGDAVLGLVCMVLLLVLKLMRDHVLPLHPEMPPGVRLSH
GLVWVATTARNALVVFFAALVAYSFEVTGYQPFMLTEETAEGLPPVWTPPFSMTTANNSV
SSEVAWRSGLICEPLKQEVESAEMSKGGTASENNYRIDANQELLAIGLTNVLGSLVSSYP
VTGSFGRTAVNAQSGVCTPAGGLVTGALVLLSLAYLTSQFHYIPKAALAAVIIMAVAPLF
DTKIFRTLWRVKRLDLLPLCVTFLLCFWEVQYGILAGALVSLFLLLHDVARPGTQVSEGP
VIVLQLASGLHFPAVESLREAILSRALEVSPPRCVVLECTHVCSIDYTVVLGLSDLLQDF
HKQGASLVFVGLQVPVLRVLLSADLQGFQYFSTVEEAEKYLRQEPGTQPYHISEDSLPEH
KVALLKA
Download sequence
Identical sequences H0WWG2
ENSOGAP00000006720 ENSOGAP00000006720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]