SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006741 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006741
Domain Number 1 Region: 185-290
Classification Level Classification E-value
Superfamily SRCR-like 1.01e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000986
Further Details:      
 
Domain Number 2 Region: 55-163
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 471-574
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 4 Region: 342-446
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006741   Gene: ENSOGAG00000007534   Transcript: ENSOGAT00000007538
Sequence length 575
Comment pep:known_by_projection scaffold:OtoGar3:GL873596.1:1383006:1392875:1 gene:ENSOGAG00000007534 transcript:ENSOGAT00000007538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKEAEMRICPQQDEKTRGWRQGDRSTAPSPLSPVLSFLLLLPLASALQPTALPFPELRL
VGGPSRCRGRLEVLHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPQPLAFGQGRGPI
LLDNVECRGQEAALSECGSRGWGVHNCFHYEDVAVLCDEFLPTRPPTRKVLTSRTPPMTP
QNVKGEGSVRLVGGANPCQGRVEILHGSLWGTVCDDDWGLPDAAVVCRQLGCGAALAATT
NAFFGFGTGHILLDNVHCEGSEPHLAACLSLGWGVHNCGHHEDAGVLCAALGPPTLTALP
PSATREDWAWHSEPAATRVGAHPSRETAVLTTVTWAAGKKSGRLRLVGGPGPCRGRVEVL
HAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLDNVGCAGTEARL
SDCFHLGWGQHNCGHHEDAGALCAGPEELGLQAQQDGSETTRVSTPRPRDGHLRLANGAH
RCEGRVELFLGQRWGTVCDDAWDLRAAGVLCKQLGCGRALAAPGEAHFGPGQGPILLDNV
KCRGDESTLLLCSHIRWDAHNCDHSEDASVLCRPS
Download sequence
Identical sequences H0WWI2
ENSOGAP00000006741 ENSOGAP00000006741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]