SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006768 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006768
Domain Number 1 Region: 239-457
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.67e-87
Family Fibrinogen C-terminal domain-like 0.00000069
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000006768
Domain Number - Region: 119-155
Classification Level Classification E-value
Superfamily GAF domain-like 0.0161
Family GAF domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006768   Gene: ENSOGAG00000007565   Transcript: ENSOGAT00000007568
Sequence length 461
Comment pep:known_by_projection scaffold:OtoGar3:GL873606.1:6509077:6539690:1 gene:ENSOGAG00000007565 transcript:ENSOGAT00000007568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNDRWKTMGGASQLEDRPRDKPQRPSCGYVLCTVLLSLAVLLAVAVTGAVLFLNHAHAP
GTAPPPIVSTGAAGVNSALVTVERADSSHLSILIDPRCPDLSDGFARLEGAQASVLQALA
VHQAQPRLPGEQEQELLDTLAEQLPRLLSRASELQEECVGLRKGHGTLGQGLSALQSEQG
RLLQLLSESQGHMAHLVNSVSDVLDALQRDRGLGRPRVKADLQRAPARGARPRGCAGGSR
PRDCLDVLLSGQQDDGVYSVFPIHYPAGFQVYCDMRTDGGGWTVFQRREDGSVNFFRGWE
AYRDGFGKLTGEHWLGLKRIHALTTQAAYELHVDLEDFDNGTAYAHYGSFGVGLFSVDPE
EDGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYHGAWWYRNCHTSNLN
GQYLRGAHASYADGVEWSSWTGWQYSLKFSEMKIRPVREDH
Download sequence
Identical sequences H0WWK5
ENSOGAP00000006768 ENSOGAP00000006768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]