SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006779 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006779
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 1.03e-54
Family Globins 0.000000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006779   Gene: ENSOGAG00000007576   Transcript: ENSOGAT00000007580
Sequence length 147
Comment pep:novel scaffold:OtoGar3:GL873520.1:33220407:33221874:-1 gene:ENSOGAG00000007576 transcript:ENSOGAT00000007580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLTPDEKNAVCALWGKVNVEEVGGEALGRLLVVYPWTQRFFDSFGDLSSPSAVMGNPK
VKAHGKKVLSAFSEGLNHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVVVLAHHFG
KDFTPQVQAAYQKVVAGVATALAHKYH
Download sequence
Identical sequences B4USM4 Q03901
XP_003781034.1.62490 ENSOGAP00000006779 ENSOGAP00000006779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]