SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006793 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006793
Domain Number 1 Region: 83-306
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-58
Family DBL homology domain (DH-domain) 0.00019
Further Details:      
 
Domain Number 2 Region: 290-422
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-30
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 
Domain Number 3 Region: 410-516
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.37e-23
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 
Domain Number 4 Region: 545-639
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-19
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006793   Gene: ENSOGAG00000007590   Transcript: ENSOGAT00000007596
Sequence length 654
Comment pep:known_by_projection scaffold:OtoGar3:GL873550.1:7737779:7762377:1 gene:ENSOGAG00000007590 transcript:ENSOGAT00000007596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKESEEKLASVPNLVTVFENSRYRVLGVGRRTPGAVPRAHRPPHTPGPWENPDVGETLE
SGPRTVSRRYLSSLKNKLSSGAWRKSCHPGTCPGPGTQEPEEKRIVQELLETEQAYVARL
HLLDQVFFQELLRTARSSKAFPEEVVRIIFSNISSIYQFHAQFFLPELQRRLDDWMVTPR
IGDVIQKLAPFLKMYSEYVKNFERAAELLATWTEKSPPFQEVITRIQSSEASGSLTLQHH
MLEPVQRIPRYELLLKEYVQKLPAQAPDQADAQKALDMIFSAAQHSNAAITEMERLQDLW
EVYQRLGLDDDIVDPSNTLLREGPVLKISFRRSDPLERYLFLFNNMLLYCVPRVIQVGAQ
FQVRTRIDVAGMKVRELTDAEFPNSFLVSGKQRTLELQARSREEMISWMQACQAAIDQIE
RRNETFKAAGQGPEGDTQEQELKSEELGLRAPQWVRDKMVTMCMRCQEPFNPLMRRRHHC
RACGYVICAKCSDYRAQLKYDDNKPNRVCYACYTFLTGNVLPEDKDDKRRGILEKGSSAG
PDRNLMCSFLQLAGDKWGKSGPRGWCVIPRDDPLVLYVYAAPQDMRAHTSIPLLGYQVTT
GTQGDARVFQLQQSGQLYTFKAETEELRDRWVKAMERAASGWSPEKTHDGDLSD
Download sequence
Identical sequences H0WWM6
ENSOGAP00000006793 ENSOGAP00000006793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]