SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006797 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006797
Domain Number 1 Region: 156-346
Classification Level Classification E-value
Superfamily E set domains 2.57e-64
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000191
Further Details:      
 
Domain Number 2 Region: 50-170
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-18
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006797   Gene: ENSOGAG00000007599   Transcript: ENSOGAT00000007600
Sequence length 376
Comment pep:known_by_projection scaffold:OtoGar3:GL873699.1:1313379:1314509:-1 gene:ENSOGAG00000007599 transcript:ENSOGAT00000007600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPIHVSMSSAPLVKHTAAGAGLKSTRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVI
DMKWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPGEPISNHTPCIMKVDSLTGAFL
FSLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIK
FSHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHITKEGERILLNQATVKFHV
DSSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKEFELVVLLNATVESTSAVCQSRTS
YVPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQKLEEKYRQED
QRDRELRTLLLQQSNV
Download sequence
Identical sequences H0WWN0
ENSOGAP00000006797 XP_003800705.1.62490 ENSOGAP00000006797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]