SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006810 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006810
Domain Number 1 Region: 3-226
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.46e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0052
Further Details:      
 
Domain Number 2 Region: 312-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.14e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006810   Gene: ENSOGAG00000007611   Transcript: ENSOGAT00000007614
Sequence length 540
Comment pep:novel scaffold:OtoGar3:GL873535.1:25252705:25274219:-1 gene:ENSOGAG00000007611 transcript:ENSOGAT00000007614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKRIAVIGAGISGLGAIKCCLDEGLEPTCFERSDDIGGLWKFQKNTSDKMPSIYKSVT
INTSKEMMCFSDFPTPDHFPNYMHNSRLMDYFRMYAKHFDLLNYIRFKTKVRSVRKHPDF
PLNGQWDVVVETDEKQETLVFDGVLVCSGHHTDPYLPLQSFPGIEKFEGCYFHSREYKSP
EDFLGKRIIVVGTGNSGVDIAVELSHVAKQVFLSTRRGSWILHRVWNNGYPMDVSFFTRF
NNFLWKILTTSQINNQLEKIMNSRFNHAHYGLQPQHRPLSQHPTVNDDLPNHIISGKVQV
KPNVKEFTETDAIFDDGTVEENIDVVIFATGYSFSFPFLDGLIKVNDNEVSLYKLMFPPD
LEKPTLAVIGLIQPLGIVLPIAELQSRWATRVFKGLSKLPSMSNMMADIAKRKRTTEKRY
VKTPRHTIQVDHIEYMDEIATLAGVKPNLLFLFLSDPKLAIEVFFGPCTPYQYRLQGPGK
WDGARRAILTQRERILKPLRTRIPNEDSHSSSQLSWVKMVPVGLAFLAAGLAYFRYIHRS
Download sequence
Identical sequences H0WWP1
ENSOGAP00000006810 ENSOGAP00000006810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]