SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006816 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006816
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily PH domain-like 9.47e-40
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000765
Further Details:      
 
Domain Number 2 Region: 207-306
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 2.62e-35
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000662
Further Details:      
 
Domain Number 3 Region: 386-497
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 5.62e-25
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006816   Gene: ENSOGAG00000007616   Transcript: ENSOGAT00000007621
Sequence length 509
Comment pep:known_by_projection scaffold:OtoGar3:GL873556.1:5108348:5180180:1 gene:ENSOGAG00000007616 transcript:ENSOGAT00000007621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGQQQPPPQRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKK
CSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALN
FANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVN
NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCG
ISEAQLKDKETSKAIYDFIEKTGGVEAIKNELRRQAPPPPPPPSRGGPPPPPPPPPPHSS
GPPPPPARGRGAPPPPPPSRAPTAAPPPPPPSRPGVGVPPPPPNRMYPPPPPALPSSAPS
GPPPPPPPLSVAGSVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTPAGSKAALLDQIREG
AQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQ
KRSKAIHSSDEDEDEDDDEDFEDDDEWED
Download sequence
Identical sequences H0WWP5
ENSOGAP00000006816 XP_003789824.1.62490 ENSOGAP00000006816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]