SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006819 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006819
Domain Number 1 Region: 683-829
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.51e-41
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 219-352
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-21
Family Phosphotyrosine-binding domain (PTB) 0.024
Further Details:      
 
Domain Number 3 Region: 7-89
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-21
Family PDZ domain 0.0072
Further Details:      
 
Domain Number 4 Region: 954-989
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000284
Family Ras-binding domain, RBD 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006819   Gene: ENSOGAG00000007608   Transcript: ENSOGAT00000007624
Sequence length 990
Comment pep:known_by_projection scaffold:OtoGar3:GL873717.1:2082017:2146465:1 gene:ENSOGAG00000007608 transcript:ENSOGAT00000007624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRAGERRPPRVRGVELARGRAGYGFSLSGQAPCALSGVLRGSPADLVGLRAGDQILAVN
DINVRKASHEDVVKLIGKCSGVLHMVVGEGAGHLESSSDEEGALYEGKGWLKPKLDSKAL
GINRAERVVEEMQSGGIFNMIFENPSLCKGSSEPLKLKQRSLSESAASRCDVGHESVNNP
NPHVLSKEEVSQVIHDDSVFSIGLENHDDFGLEASILNVAMVVGYLGSIELPSTSSSLES
DSLQAIRGCMRRLRAEQKIHSLVTMKIVQDCVQLCADKAGVVAEYPAEKLAFSAMCPDDR
RFFGLVTMQTSDDGSLAQEEEGALRTSCHVFMVDPDLFNHKIHQGIARRFGFECTADPDT
NGCLEFPASSLPVLQFISVLYRDMGELIEGVRARAFLDGDADAHQNNSTSSNSDSGIGNF
NQEEKSNRVLVVDLGGNSSRHGPGGSTMWEGTGGRASQPWGAPWNGAFCHDPEGSSPLEV
TPQTDRFWDSNKHLGPASHVEVPPASLRSSVPPSKRAAAGVGGGFNQRWLPVHVLQEWQC
GHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSFAQPPLGSQKRDWSRKAFG
MQNIFGPHRNVRKTKEDKKGSKFGRGIGLTQTSQRPSTRRSFGRSKRFSITRSLDDLESA
TVSDGELTGADLKDCVSSNSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPLGVHY
FSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQA
QLADDILNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRALPDSQQAP
SSPASKHSLSSDHSSVSTPKKLSGKSKSGRSLNEELGEEDSERRRRGAFFSWSRTRSTGR
SQKKKEHGDLANDSHNANGGPCRRESQGSVSSSGSLDLSEACRTLAPERDKATKHCCILL
PDGTSCVVAVKAGFSIKEILLGLCERHGIN
Download sequence
Identical sequences H0WWP6
ENSOGAP00000006819 ENSOGAP00000006819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]