SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006829 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006829
Domain Number 1 Region: 404-707
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.62e-103
Family PDEase 0.000000491
Further Details:      
 
Domain Number 2 Region: 190-381
Classification Level Classification E-value
Superfamily GAF domain-like 5.67e-48
Family GAF domain 0.000029
Further Details:      
 
Domain Number 3 Region: 33-182
Classification Level Classification E-value
Superfamily GAF domain-like 4.8e-20
Family GAF domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006829   Gene: ENSOGAG00000007629   Transcript: ENSOGAT00000007634
Sequence length 722
Comment pep:known_by_projection scaffold:OtoGar3:GL873575.1:3322258:3408865:1 gene:ENSOGAG00000007629 transcript:ENSOGAT00000007634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAPSFYSKYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATNADGFALYFL
GECNNSLCIFTPPGVKEGRPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGT
GLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKDAFCLSHQEVATANLAWASVAIHQV
QVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNK
ELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVD
LYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANM
YHRIRHSECIYRVTMEKLSYHSICTAEEWQGLMHFTLPLRLCKEIELFHFDIGPFENMWP
GIFVYMVHRSCGTTCFDLEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQSTQEL
FTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEG
HNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQSGLLNLNNQSHRDRVIG
LMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKSDEVPQGQL
GFYNAVAIPCYTTLTQILPPTEPLLKACRDNLQQWEKVIRGEESAVWISALPTAQGASEK
PP
Download sequence
Identical sequences H0WWQ5
ENSOGAP00000006829 ENSOGAP00000006829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]