SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006921 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006921
Domain Number 1 Region: 248-483
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-55
Family DBL homology domain (DH-domain) 0.0000403
Further Details:      
 
Domain Number 2 Region: 483-607
Classification Level Classification E-value
Superfamily PH domain-like 4.02e-32
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 
Domain Number 3 Region: 54-117
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006921   Gene: ENSOGAG00000007724   Transcript: ENSOGAT00000007737
Sequence length 1089
Comment pep:known_by_projection scaffold:OtoGar3:GL873548.1:9821996:9881062:1 gene:ENSOGAG00000007724 transcript:ENSOGAT00000007737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLPQSPSKKDFEGKSGTKVSRTFSYIRNKMSSSKKSKEKEKEKEKTKEKEKDSKEKEKDK
KTLNGHTFSSIPVVGPISCGQCMKPFTSKDAYTCANCGAFVHKGCRESLASCAKIRMKQP
KGSLQAHDTSSLPTVIMRNKPSQPKERPRSAVLLADETTTTPMFANRRSQQSVSLSKSVS
IQNITGVGSDENMSNTWKFLSHSTDSLNKISKVNESTESLTDEGVGTDMNEGQLMGDFEI
DSKQLEAESWSRIVDSKFLKQQKKDVVKRQEVIYELMQTEFHHLRTLKIMSDVYSRGMMT
DLLFEQQMVEKLFPCLDELISIHSQFFQRILERKKESLVDKNEKNFLIKRIGDVLVNQFS
GENAERLKKTYGKFCGQHNQSVNYFKDLYTKDKRFQAFVKKKMSSSVVRRLGIPECILLV
TQRITKYPVLFQRILQCTKDNEAEQDDLAQSLSLVKDVIGAVDSKVASYEKKVRLNEIYM
KTDSKSIMRMKSGQMFAKEDLKRKKLVRDGSVFLKSATGRLKEVQAVLLTDILVFLQEKD
QKYIFASLDQKSTVISLKKLIVREVAHEEKGLFLISMGMRDPEMVEVHASSKEERNSWIQ
IIQDTINTLNRDEDEGIPSENEEEKKMLDTKARELKEQLQQKDHQILLLLEEKEMIFRDM
AECSTPLPEDYSPTQSPRILFRSNTEEALKGGPLMKSAINEVEILQSLVSGSLGGTLGQA
ISNPIELENMVGPISLPRRAETFGGFDSHQMNASKGGEKEEGDDGQDLRRTESDSGLKKG
GNANPMFMLKRNNEQLVQSIVHLHELLSTLQGVVLQQDSHIEDQKLLLSERALTRSLSRP
SSLIEQEKQRSLEKQRQDLANLQRQQAQLLEDRRRREREWEARERDLQEREARLAQREEK
VQRGQQDLERDWEELQQRKGAYQCDLERLRASQRQLERDREQLRRDVAERLSQTQVERSL
CPEVSHQHTKLMRIPSFCPSPEASPLPSAPSVAKSGSLDSELSASPRRNSISRTHKEKVP
FHILSSTGQPDRAPGGQSQAPVPTSAPARLFGLAKPKEKKDKKKKSKASRSQPGDGPAEV
SAEGEEIFC
Download sequence
Identical sequences H0WWX9
ENSOGAP00000006921 ENSOGAP00000006921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]