SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006964 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006964
Domain Number 1 Region: 108-321
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-45
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 332-455
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-19
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006964   Gene: ENSOGAG00000007778   Transcript: ENSOGAT00000007782
Sequence length 534
Comment pep:known_by_projection scaffold:OtoGar3:GL873521.1:27529634:27572348:1 gene:ENSOGAG00000007778 transcript:ENSOGAT00000007782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKQENPIVFCCLFRRGEENGSDSADQCTASSLCILTLQEPSNKRVKPLSRVTSLANLIPP
VKATPLKRFSQTLQRSISFRSDSRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQ
MLTAKEIKRQEGGVEEEEIREDKYLLPFLALLMQAYHDPMLKLSIMTEQELNQIFGTLDS
LIPLHEELLSQLRDVRKPDGSTEHVGPILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDH
RVQDFLQRCLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAIN
IIQGIVAEINTKTGESECRYYKERLLYLEEGQKDSLIDNSRVLCCHGELKNNRGVKLHVF
LFQEVLVITRAITHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKN
FFRVSFKNGSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGPFLNPTT
GSREPQAETKLEQMDQSDSESDCSMDTSEVSLDCERMEQTDSPCGNSRQVESHV
Download sequence
Identical sequences H0WX13
ENSOGAP00000006964 ENSOGAP00000006964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]