SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000006970 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000006970
Domain Number 1 Region: 3-207
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-45
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 195-323
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000487
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000006970   Gene: ENSOGAG00000007784   Transcript: ENSOGAT00000007788
Sequence length 323
Comment pep:known_by_projection scaffold:OtoGar3:GL873691.1:662573:666488:1 gene:ENSOGAG00000007784 transcript:ENSOGAT00000007788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARCPVQEQRARWERKRACTVRELLETEQRYQEQLGLVATYFLGILKAKGTLRPPERQALF
GSWELIYDASQQLLPYLEGGYWGPGLEGFCRHLELYTQFAANADRSQATLQEQLKKNKCF
RRFVRLQESRPEFRGLQLQDLLSLPLQRLQQYENLVVALAENTGPNSPDYKQLTRAARLI
SETAQRVHTIDQKQKNDQHLRRVQALLSGRQAKGLTSGRWFLRQGWLLVVPPHGEPRPRM
FFLFSDALLMAKPRPPLHLLQSGTFACKALYPMAQCQLHKVFGHSGGPCGGLLSLSFPHE
KLLLMSTDQEELSCWYHSLTLAI
Download sequence
Identical sequences H0WX19
ENSOGAP00000006970 ENSOGAP00000006970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]