SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007069 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007069
Domain Number 1 Region: 152-360
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-54
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 342-477
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-31
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 3 Region: 452-493,531-594
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.63e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0032
Further Details:      
 
Domain Number 4 Region: 618-713
Classification Level Classification E-value
Superfamily PH domain-like 4.03e-20
Family Pleckstrin-homology domain (PH domain) 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007069   Gene: ENSOGAG00000007894   Transcript: ENSOGAT00000007899
Sequence length 737
Comment pep:known_by_projection scaffold:OtoGar3:GL873607.1:7541760:7583881:-1 gene:ENSOGAG00000007894 transcript:ENSOGAT00000007899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGGTSSTPPGLPAALGMTDAGPGSSSLGKLRALPVGPRAHCRDPGSPAAAGDSSPDTG
PVGELSSGMKIPNRDSGIDSPSSSMAGENFPSEEGSEASPGPAVLGLNPETAPHSQVLQD
TPQEEADSDVGEEPDLENSAPRADKVASLAQHSDPQKLLHIAQELLHTEETYVKRLHLLD
QVFYTRLSEAGIPPEVTTGIFSNISSIHRFHGQFLLPELQTRITEEWDMNPRLGDILQKL
APFLKMYGEYVKNFDRAVGLVSTWTQRSPLFKDVVHSIQKEEVCGNLTLQHHMLEPVQRV
PRYELLLKDYLKRLPGDALDRKDAERSLELISTAANHSNAAIRKVEKMHKLLEVYEQLGG
EEDIVNPANELIKEGHIQKLSAKNGTTQDRHLFLFNSMILYCVPKLRLMGQKFSVREKMD
ISGLQVQDIVKPNAAHTFIITGRKRSLELQTRTEEEKKEWIQIIQATIEKHKQNSETFKA
FGGSFSPDEDPSLPPEMPMGNTSSGESAVMTEGSSATTGLEPRKLSSKIRRDKEKQSCKS
CGETFNSITKRRHHCKLCGVVICGKCSEFKAENSRQSRVCRECFLTQPVVPESPSPEASA
EPKQSTEKPPTVEPRPSLFCGPLRLLDSGEAWSEVWATIPVSDPQVLHLQGGSQDSRLPL
TIPLTNCMVSVPDPKERPDSGHVWKLQRAQQSWYLSAPSAELQQQWLEALSTATQGDMAQ
DNPGTLQLQAPVDAAAL
Download sequence
Identical sequences H0WXA2
ENSOGAP00000007069 XP_012663801.1.62490 ENSOGAP00000007069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]