SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007081 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007081
Domain Number 1 Region: 428-618
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.11e-53
Family cAMP-binding domain 0.00000000555
Further Details:      
 
Domain Number 2 Region: 163-431
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-36
Family Voltage-gated potassium channels 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007081   Gene: ENSOGAG00000007910   Transcript: ENSOGAT00000007913
Sequence length 848
Comment pep:known_by_projection scaffold:OtoGar3:GL873548.1:13254250:13284930:1 gene:ENSOGAG00000007910 transcript:ENSOGAT00000007913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAPAPPQQPPRTEAAPPEATDECGPRARLRSRDSSCGRPGTPGAASTAKGSPNGECGRGE
PQCSPAGPEGPVRGPKVSFSCRGAAAGPAPGPGAGPAPADEAGSEEAGPAGEPRGSQASF
MQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFM
VGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIEDNTEIILDPEKI
KKKYLRTWFVVDFVSSIPVDYIFLIVEKGIDSEVYKTARALRIVRFTKILSLLRLLRLSR
LIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPRNCWVSI
NGMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHA
TALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGEL
NGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMY
FIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVL
EEYPMMRRAFETVAIDRLDRIGKKNSILLHKVQHDLNSGVFNNQENAIIQEIVKYDREMV
QQAELGQRVGLFPPPPPPQVTSAIATLQQAVAMSFCPQVARPLVGPLALGSPRLVRRLPP
GPAPAASPGPAAPTSPPGAPASPRVPRTLPYGGTPGSPAAPRAGPALPARRLSRASRPLS
ASQPSLPHGAPGPTASARPASSSTPRLGPAPAARAAAPSPDRRDSASPGAAGGLDPLDSA
RSRLSSNL
Download sequence
Identical sequences H0WXB3
ENSOGAP00000007081 ENSOGAP00000007081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]