SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007142 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007142
Domain Number 1 Region: 160-424
Classification Level Classification E-value
Superfamily RNI-like 7.59e-42
Family 28-residue LRR 0.04
Further Details:      
 
Domain Number 2 Region: 73-146
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000903
Family F-box domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007142   Gene: ENSOGAG00000007976   Transcript: ENSOGAT00000007980
Sequence length 455
Comment pep:known_by_projection scaffold:OtoGar3:GL873549.1:10730536:11213622:1 gene:ENSOGAG00000007976 transcript:ENSOGAT00000007980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAGCCQGPEQPLCPPPSSPAPEGVPSEAGGDAVRAGGTAPSSAQQQHECGDADCQEPPEN
PCDCHKESPSETPDINQLPPSILLKIFSNLSLDERCLSASLVCKYWRDLCLDFQFWKQLD
LSSRQQVTDELLEKIASRSQNIIEINISDCRSMSDTGVCVLAFKCPGLLRYTAYRCKQLS
DTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIVIA
KGCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLRNLSSLD
LRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLVSCKITD
YALIAIGRYSMTIETVDVGWCKEITDRGATLIAQSSKSLRYLGLMRCDKVNEVTVEQLVQ
QYPHITFSTVLQDCKRTLERAYQMGWTPNMSAASS
Download sequence
Identical sequences H0WXG2
ENSOGAP00000007142 ENSOGAP00000007142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]