SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000007143 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000007143
Domain Number 1 Region: 289-393
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 9.25e-29
Family Lipoxigenase N-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000007143
Domain Number - Region: 988-1052,1085-1152,1188-1217
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00314
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000007143   Gene: ENSOGAG00000007970   Transcript: ENSOGAT00000007981
Sequence length 1241
Comment pep:known_by_projection scaffold:OtoGar3:GL873566.1:3566711:3611698:1 gene:ENSOGAG00000007970 transcript:ENSOGAT00000007981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLHNNPCSWFQMMSFPKSPFQAQSHFDVSGTVGGLCLTSPSGRLIPVMNLSENIEILLPR
PPERHSDPTVLNLTSPEALQVNVTSREAALGIQLHWRPSIRLTLSLGFGYHPNETSYDAQ
THLLPAAAPADEMSTWILSPRDLHFGEGVYYLTVVPEADMEPASGRDLTVGITTFLSHCV
FWDEVQEMWDNSGCQVGPRTSPSQTHCLCNHLTFFGSTFLVMPNAVDVRQTAELFATFED
NPVVVATVGCLCVVYVLAVIWARRKDAQDQAKVKVTVLEDNDPFAQYHYLVTVYTGHRRG
AATSSKVTLTLYGLDGESEPHHLSDPDTPVFERGGVDAFLLSTLFPLGELQSLRLWHDNS
GDRPSWYVSRVLVCDLAMDQKWYFLCNSWLSIDVGDCVLDKVFPVATEQDRKQFSHLFFM
KTSTGFQDGHIWYSIFSRSAWSNFTRVQRVSCCFSLLLCTMLTSIMFWSIPQDPAEQKMD
LGKIEFTWQEVMIGLESSLLMFPINLLIVQIFRNTRPRAVKELDTKKISLCLSLLSSLPS
MLLLTVNDYLEHLALNNSNEVYVLCLCQHDPWCMWPASYLLRQCLYLQLKHLEQALQLVG
PHGFPQQHSHTRALQQLQTLKGCLGGQPGSLAPAYTSPDPLPQAEMIQNSSEYSGRPGTY
SPLKSTSQFMTIVIRMSRPPGGLPWWCIFVGWLLVAATSVVAAFFTMLYGLHYGRASSLR
WLLSMAVSFMESMFITQPLKVLGFAAFFALVLKRVDEEEDMTAPLAGHLSHPDSLVPLGR
RNSSRDVYQPPLTTTIEKMRAAHLKEQKAFALIREILDPSFFLTLKILQQPLLAIRTKFK
CPTVASATLSALSGPRKPLDVAAEWGVHIWLDGLQNRAKGKKKVVNDTHVGLGLFLTAKP
VLPTNTEARDRPGMVYFRIRAGRCGRNTLPFPWGILCLRRTIVTILVKLASKHPYPQIIT
KQKSKNKKNKKKTLKCTFFTHAALQSLRLYPFTDGWHPFVVAAELVYFLFLLYYMVVQGK
LMRRQKWGYFRSKWNLLELTIILASWSALAMFVKRAILAERDIQHCRTHRKEGVSFGETA
AADAAVGYIMAFLVLLSTVKLWHLLRLNPKMNMITSALRRAWGDISGFVIVILIMLLAYS
IASNLIFGWKLRSYKTLFDAAETMISLQLGVFNYEEVLAYSPVLGSFLIGSCIVFMTFVV
LNLFISVILVAFSEEQKCPQLSEEGEIADLLLMKILSLLGI
Download sequence
Identical sequences H0WXG3
ENSOGAP00000007143 ENSOGAP00000007143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]